Close

MMGT1 Membrane Protein Introduction

Introduction of MMGT1

The membrane magnesium transporter 1 (MMGT1) in humans is encoded by the MMGT1 gene. MMGT1 belongs to the magnesium transporter1 (MagT1) family which is a group of magnesium transporters that are part of the TOG superfamily. MMGT1 is described as having 335 amino acids and five TMSs with an N-terminal cleavage site and a number of phosphorylation sites.

Basic Information of MMGT1
Protein Name Membrane magnesium transporter 1
Gene Name MMGT1
Aliases EMC5, TMEM32
Organism Homo sapiens (Human)
UniProt ID Q8N4V1
Transmembrane Times 2
Length (aa) 131
Sequence MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Function of MMGT1 Membrane Protein

Membrane magnesium transporters are proteins that transport magnesium across cell membranes and are ubiquitously expressed in all human tissues. Magnesium is required for all forms of life. Knocking out the MMGT1 protein reduces the concentration of Mg2+ in mammalian cell lines and leads to early developmental arrest. MMGT1 also mediates saturable Mg2+ uptake with a Km of 0.23 mM. Furthermore, the transport of MMGT1 to Mg2+ is chilled, voltage-dependent, and shows no time-dependent inactivation, presumably MagT1 has an N-terminal thioredoxin domain of unknown function. In addition, the ATPase function of MMGT1 is highly dependent on cardiolipin and has been shown to detect free magnesium in the μM range. However, the molecular mechanism of uptake of Mg2+ from the environment and the function of the Mg2+ transporter is not clear.

MMGT1 Membrane Protein IntroductionFig.1 Structure of MgtE Mg2+ channel. (Moomaw, 2008)

Application of MMGT1 Membrane Protein in Literature

  1. Trapani V., et al. The role of MAGT1 in genetic syndromes. Magnesium Research. 2015, 28(2):46-55. PubMed ID: 26422833

    This review focuses on magnesium transporter 1 (MAGT1), which identifies genetic alterations and their functional consequences in immunodeficient patients, suggesting that magnesium and MAGT1 are key molecular players in T cell-mediated immune responses.

  2. Wolf F.I., et al. A highly specific magnesium channel with important roles beyond cellular magnesium homeostasis. Magnesium Research Official Organ of the International Society for the Development of Research on Magnesium. 2011, 24(3):86-91. PubMed ID: 21947671

    The article reviews the results of magnesium homeostasis research and discusses their potential impact on disease treatment, which is the key to understanding the relevant pathophysiological conditions and their treatment.

  3. Ferrè S., et al. Insight into renal Mg2+ transporters. Curr Opin Nephrol Hypertens. 2011, 20(2):169-176. PubMed ID: 21191290

    This review describes recent hypothetical findings regarding novel magnesium transporters in renal transport epithelial cells, which may be the key to supplementing current knowledge about magnesium treatment in the kidneys.

  4. Zhou H. and Clapham D.E. Mammalian MagT1 and TUSC3 are required for cellular magnesium uptake and vertebrate embryonic development. Proc Natl Acad Sci U S A. 2009, 106(37):15750-15755. PubMed ID: 19717468

    The article shows that MagT1 and TUSC3 are indispensable members of the Mg2+ transport system of the spinal motor membrane. Two mammalian genes, MagT1 and TUSC3, are identified by yeast complementary screening, which are the main mechanisms of Mg2+ influx.

  5. Goytain A., et al. Identification and characterization of a novel family of membrane magnesium transporters, MMgT1 and MMgT2. American Journal of Physiology Cell Physiology. 2008, 294(2):C495-502. PubMed ID: 18057121

    The article shows that MMGT regulates the transport of Mg2+ in Golgi derived from epithelial cells via identifying the expression of MMgT1 and MMgT2 mRNA in the renal cortex of mice and the expression of MMgT1 and MMgT2 in Golgi and Golgi posterior vesicles.

MMGT1 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, we also provide customized anti-MMGT1 antibody development services based on our versatile MemDX™ anti-membrane protein antibody discovery platform.


Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.

Reference

  1. Moomaw A S and Maguire M E. (2008). The unique nature of Mg2+ channels. Physiology. 23(5), 275-285.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us